PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi11g11130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 1013aa    MW: 111875 Da    PI: 8.0357
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi11g11130.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.11.7e-4089166178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqv++C++dls+ak+yhrrhkvCe+hska+++l+s+++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Vradi11g11130.1  89 MCQVDNCREDLSKAKDYHRRHKVCEAHSKASKALLSNQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 166
                      6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-3484151IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.96687164IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-3788168IPR004333Transcription factor, SBP-box
PfamPF031107.9E-3090163IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.03E-6759905IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.7E-6760910IPR020683Ankyrin repeat-containing domain
CDDcd002045.13E-6760903No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1013 aa     Download sequence    Send to blast
MEKVAAPPIL MQRKRDLSYG VVAGSPSESW KWEWDSVRFA GKPPSDDVVF EEESVAAVAP  60
LQLNLAGRVS GGGNKRVRSG SPGTATYPMC QVDNCREDLS KAKDYHRRHK VCEAHSKASK  120
ALLSNQMQRF CQQCSRFHPL SEFDEGKRSC RRRLAGHNRR RRKTQPEDVT SATQVPAAAV  180
AAAANLEIFN LLTAIAGASQ GKFEERSQVP DREQLVQILN RIPLPADLAT KLRDAGNVNG  240
KKDHVQSETP SSYHHHDQLN HTPATPLTMD LLAVLSTSLS GSGPDANASP SQNRSCSSDG  300
GSVKSRSSAD QTRQQHFFSV GGERSSSSSQ SPVEDSDCQE DVRVNLPLQL FSSSPEEDSL  360
PKLASSRKYF SSDSSNPAEE RSPSSSPPSP PVVEMQFDLQ GGATGLKPES ISSGRGVNSN  420
KEASQSHSCN ISLDLFKGSN KRIQQPSWLQ SVPFQAGYTS SGSDHSPPSL NSDAQDRTGR  480
IMFKLFDKHP SHFPETLRAQ IYSWLSNRPS DMESYIRPGC VVLSLYASMS SAAWEKLEEN  540
FLQHVHSLIQ NSDSDFWRSG RFLVHSGSQL ASHKDGKVRI CKPWRTWKSP ELISVSPLAI  600
VSRQETSISL KGRNLSTPGT KIHCTGTGSY SSAEVIRSSY PGVVYDNIKL SGFKVQDVSP  660
GVVGRFFIEI ENGFKGNSFP VIIANETICN ELRLLESEFN EEEKICDAIS EEHEHNFGRP  720
RSREEALHFL NELGWLFQRE RFSYMHEVPC YSLDRFKFVL TFAVERNCCM LVKTLLDVLV  780
DKHLQGESLS TGSVEMLNAI QLLNRAVKRK NIGMVDLLIH YSLPNKNSTS SKYVFPPNLE  840
GPAGITPLHL AACTSGSEGV VDSLTSDPQE IGLKCWESLV DANGQTPHAY AMMRNNNSYN  900
VLVARKLADR RRAEISVTIE NEVEQASLRV ELNQKQSNLL KRGQSSCAKC ATAEIRYNRR  960
FSGSHGLLHR PFIYSMLAVA AVCVCVCVFF RGRPCVGSVA PFSWETLDFG TM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3380163184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520750.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A0L9UTT60.0A0A0L9UTT6_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T0S70.0A0A0S3T0S7_PHAAN; Uncharacterized protein
STRINGGLYMA20G00900.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14